Product Name: RVG-9R-MyD88 (194-220)
Product Number: PE-01AAS95
Size: 200 µg      Price:154.00
1 mg      $US307.00
5 mg      672.00
Peptide Name: RVG-9R-MyD88 (194-220)

Peptide Production Method: Solid-phase peptide synthesis

Peptide Origin: Rabies virus

Peptide Sequence: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRRRDVLPGT

Peptide Modifications N Terminus: Free amino

Peptide Modifications C Terminus: Free carboxyl

Peptide Molecular Mass Calculated: 5581.2 Da

Peptide Purity Percent after Synthesis and Purification: >95

Peptide Appearance: White powder

Peptide Form: Solid

Storage Conditions: -20°C
Scientific Background: Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier. Moreover, a cell permeable derivative of the MyD88 BB-loop decoy heptapeptide (RDVLPGT) significantly reduced IL-1-induced NF-kB reporter activity and blocked MyD88 homomeric interaction in live cells.
References

[1] Kumar P, Wu H, McBride JL, Jung KE, Kim MH, Davidson BL, Lee SK, Shankar P, Manjunath N. Transvascular delivery of small interfering RNA to the central nervous system. Nature. 2007 Jul 5;448(7149):39-43. Epub 2007 Jun 17. PMID: 17572664.

[2] Loiarro M, Sette C, Gallo G, Ciacci A, Fantò N, Mastroianni D, Carminati P, Ruggiero V. Peptide-mediated interference of TIR domain dimerization in MyD88 inhibits interleukin-1-dependent activation of NF-{kappa}B. J Biol Chem. 2005 Apr 22;280(16):15809-14. Epub 2005 Mar 8. PMID: 15755740.

[3] Loiarro M, Ruggiero V, Sette C. Targeting TLR/IL-1R signalling in human diseases. Mediators Inflamm. 2010;2010:674363. Epub 2010 Apr 8. PMID: 20396389