Product Name: Cathelicidin (134-170)
Product Number: PE-01AAE95
Size: 200 µg      Price:118.00
1 mg      $US237.00
5 mg      518.00
Peptide Name: Cathelicidin (134-170)

Peptide Production Method: Solid-phase peptide synthesis

Peptide Origin: Homo sapiens

Peptide Sequence: [LL-37, 37 aa]

Peptide Modifications N Terminus: Free amino

Peptide Modifications C Terminus: Amide

Peptide Molecular Mass Calculated: 4492.2 Da

Peptide Purity Percent after Synthesis and Purification: >95

Peptide Appearance: White powder

Peptide Form: Solid

Storage Conditions: -20°C

Scientific Background: Antimicrobial peptide LL-37,  belonging  to the cathelicidin family,  is the first amphipathic alpha-helical peptide isolated from humans. LL-37 plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  It is cytotoxic to both bacterial and normal eukaryotic cells. LL-37 is significantly resistant to proteolytic degradation in solution.
References

[1] Amer LS, Bishop BM, van Hoek ML. Antimicrobial and antibiofilm activity of cathelicidins and short, synthetic peptides against Francisella. Biochem Biophys Res Commun. 2010 May 28;396(2):246-51. Epub 2010 Apr 23. PMID: 20399752.

[2] Into T, Inomata M, Shibata K, Murakami Y. Effect of the antimicrobial peptide LL-37 on Toll-like receptors 2-, 3- and 4-triggered expression of IL-6, IL-8 and CXCL10 in human gingival fibroblasts. Cell Immunol. 2010;264(1):104-9. Epub 2010 May 15. PMID: 20570250.

[3] Kooi C, Sokol PA. Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides. Microbiology. 2009 Sep;155(Pt 9):2818-25. Epub 2009 Jun 18. PMID: 19542010

[4] Dürr UH, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006 Sep;1758(9):1408-25. Epub 2006 Apr 4. PMID: 16716248.

[5] Neville F, Cahuzac M, Konovalov O, Ishitsuka Y, Lee KY, Kuzmenko I, Kale GM, Gidalevitz D. Lipid headgroup discrimination by antimicrobial peptide LL-37: insight into mechanism of action. Biophys J. 2006 Feb 15;90(4):1275-87. Epub 2005 Nov 18. PMID: 16299073.

[6] Oren Z, Lerman JC, Gudmundsson GH, Agerberth B, Shai Y. Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activity. Biochem J. 1999 Aug 1;341 ( Pt 3):501-13. PMID: 10417311.