Product Name: SUR2A
Product Number: AB-NN341-1
Size: 25 µg      Price:89.00
      $US
Target Full Name: ATP-binding cassette sub-family C member 9

Target Alias: ABCC9; Sulfonylurea receptor 2; CMD10; ABC37; Sulfonylurea receptor 2A; isoform SUR2A

Product Type Specific: ABC protein pan-specific antibody

Antibody Code: NN341-1

Antibody Target Type: Pan-specific

Protein UniProt: Q8N4N7

Protein SigNET: Q8N4N7

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG2A

Antibody Immunogen Source: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence

Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.

Antibody Potency: In mouse brain lysates, this antibody detects a ~120 kDa protein by Western blotting.

Antibody Species Reactivity: Mouse | Rat

Antibody Positive Control: 1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Antibody Specificity: High

Antibody Cross Reactivity: Does not cross-react with SUR2B. Also 3 strong cross-reactive proteins in mouse brain lysates.

Related Product 1: SUR1 pan-specific antibody (Cat. No.: AB-NN340-1)

Related Product 2: SUR1 and SUR2B pan-specific antibody (Cat. No.: AB-NN340-2)

Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).
References

[1] Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.

[2] Nichols C.G. (2006) Nature. 440 (7083): 470-476.